ST8SIA2 monoclonal antibody (M01), clone 6G6
  • ST8SIA2 monoclonal antibody (M01), clone 6G6

ST8SIA2 monoclonal antibody (M01), clone 6G6

Ref: AB-H00008128-M01
ST8SIA2 monoclonal antibody (M01), clone 6G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ST8SIA2.
Información adicional
Size 100 ug
Gene Name ST8SIA2
Gene Alias HsT19690|MGC116854|MGC116857|SIAT8B|ST8SIA-II|STX
Gene Description ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA
Immunogen Prot. Seq TIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ST8SIA2 (NP_006002, 40 a.a. ~ 146 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8128
Clone Number 6G6
Iso type IgG2a Kappa

Enviar un mensaje


ST8SIA2 monoclonal antibody (M01), clone 6G6

ST8SIA2 monoclonal antibody (M01), clone 6G6