TCL1A monoclonal antibody (M13), clone 3A4
  • TCL1A monoclonal antibody (M13), clone 3A4

TCL1A monoclonal antibody (M13), clone 3A4

Ref: AB-H00008115-M13
TCL1A monoclonal antibody (M13), clone 3A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TCL1A.
Información adicional
Size 100 ug
Gene Name TCL1A
Gene Alias TCL1
Gene Description T-cell leukemia/lymphoma 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCL1A (NP_068801.1, 61 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8115
Clone Number 3A4
Iso type IgG1 Kappa

Enviar un mensaje


TCL1A monoclonal antibody (M13), clone 3A4

TCL1A monoclonal antibody (M13), clone 3A4