IFT88 polyclonal antibody (A01)
  • IFT88 polyclonal antibody (A01)

IFT88 polyclonal antibody (A01)

Ref: AB-H00008100-A01
IFT88 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IFT88.
Información adicional
Size 50 uL
Gene Name IFT88
Gene Alias D13S1056E|DAF19|MGC26259|RP11-172H24.2|TG737|TTC10|hTg737
Gene Description intraflagellar transport 88 homolog (Chlamydomonas)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFT88 (NP_783195, 724 a.a. ~ 833 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8100

Enviar un mensaje


IFT88 polyclonal antibody (A01)

IFT88 polyclonal antibody (A01)