MLL2 monoclonal antibody (M01), clone 2E1
  • MLL2 monoclonal antibody (M01), clone 2E1

MLL2 monoclonal antibody (M01), clone 2E1

Ref: AB-H00008085-M01
MLL2 monoclonal antibody (M01), clone 2E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MLL2.
Información adicional
Size 100 ug
Gene Name MLL2
Gene Alias AAD10|ALR|CAGL114|MLL4|TNRC21
Gene Description myeloid/lymphoid or mixed-lineage leukemia 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MLL2 (NP_003473.1, 1487 a.a. ~ 1586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8085
Clone Number 2E1
Iso type IgG2a Kappa

Enviar un mensaje


MLL2 monoclonal antibody (M01), clone 2E1

MLL2 monoclonal antibody (M01), clone 2E1