MLF2 purified MaxPab rabbit polyclonal antibody (D01P)
  • MLF2 purified MaxPab rabbit polyclonal antibody (D01P)

MLF2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008079-D01P
MLF2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MLF2 protein.
Información adicional
Size 100 ug
Gene Name MLF2
Gene Alias NTN4
Gene Description myeloid leukemia factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVSPFGMLGMSGGFMDMFGMMNDMIGNMEHMTAGGNCQTFSSSTVISYSNTGDGAPKVYQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEWRRETSRFRQQRPLEFRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRRYDW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MLF2 (NP_005430.1, 1 a.a. ~ 248 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8079

Enviar un mensaje


MLF2 purified MaxPab rabbit polyclonal antibody (D01P)

MLF2 purified MaxPab rabbit polyclonal antibody (D01P)