USP5 monoclonal antibody (M02), clone 4G4
  • USP5 monoclonal antibody (M02), clone 4G4

USP5 monoclonal antibody (M02), clone 4G4

Ref: AB-H00008078-M02
USP5 monoclonal antibody (M02), clone 4G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP5.
Información adicional
Size 100 ug
Gene Name USP5
Gene Alias ISOT
Gene Description ubiquitin specific peptidase 5 (isopeptidase T)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP5 (NP_003472, 71 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8078
Clone Number 4G4
Iso type IgG2a Kappa

Enviar un mensaje


USP5 monoclonal antibody (M02), clone 4G4

USP5 monoclonal antibody (M02), clone 4G4