MFAP5 MaxPab mouse polyclonal antibody (B01)
  • MFAP5 MaxPab mouse polyclonal antibody (B01)

MFAP5 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00008076-B01
MFAP5 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human MFAP5 protein.
Información adicional
Size 50 uL
Gene Name MFAP5
Gene Alias MAGP2|MP25
Gene Description microfibrillar associated protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MFAP5 (NP_003471.1, 1 a.a. ~ 173 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8076

Enviar un mensaje


MFAP5 MaxPab mouse polyclonal antibody (B01)

MFAP5 MaxPab mouse polyclonal antibody (B01)