PDHX purified MaxPab mouse polyclonal antibody (B01P)
  • PDHX purified MaxPab mouse polyclonal antibody (B01P)

PDHX purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008050-B01P
PDHX purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PDHX protein.
Información adicional
Size 50 ug
Gene Name PDHX
Gene Alias DLDBP|E3BP|OPDX|PDX1|proX
Gene Description pyruvate dehydrogenase complex, component X
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDHX (AAH10389.1, 1 a.a. ~ 501 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8050

Enviar un mensaje


PDHX purified MaxPab mouse polyclonal antibody (B01P)

PDHX purified MaxPab mouse polyclonal antibody (B01P)