STAM purified MaxPab mouse polyclonal antibody (B02P)
  • STAM purified MaxPab mouse polyclonal antibody (B02P)

STAM purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00008027-B02P
STAM purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human STAM protein.
Información adicional
Size 50 ug
Gene Name STAM
Gene Alias DKFZp686J2352|STAM1
Gene Description signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STAM (AAH30586.1, 1 a.a. ~ 403 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8027

Enviar un mensaje


STAM purified MaxPab mouse polyclonal antibody (B02P)

STAM purified MaxPab mouse polyclonal antibody (B02P)