NUP214 polyclonal antibody (A01)
  • NUP214 polyclonal antibody (A01)

NUP214 polyclonal antibody (A01)

Ref: AB-H00008021-A01
NUP214 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NUP214.
Información adicional
Size 50 uL
Gene Name NUP214
Gene Alias CAIN|CAN|D9S46E|MGC104525|N214
Gene Description nucleoporin 214kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUP214 (NP_005076, 1 a.a. ~ 97 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8021

Enviar un mensaje


NUP214 polyclonal antibody (A01)

NUP214 polyclonal antibody (A01)