MYST3 monoclonal antibody (M07), clone 4D8
  • MYST3 monoclonal antibody (M07), clone 4D8

MYST3 monoclonal antibody (M07), clone 4D8

Ref: AB-H00007994-M07
MYST3 monoclonal antibody (M07), clone 4D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MYST3.
Información adicional
Size 100 ug
Gene Name MYST3
Gene Alias KAT6A|MGC167033|MOZ|RUNXBP2|ZNF220
Gene Description MYST histone acetyltransferase (monocytic leukemia) 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYST3 (NP_006757, 81 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7994
Clone Number 4D8
Iso type IgG2b Kappa

Enviar un mensaje


MYST3 monoclonal antibody (M07), clone 4D8

MYST3 monoclonal antibody (M07), clone 4D8