EPM2A MaxPab rabbit polyclonal antibody (D01)
  • EPM2A MaxPab rabbit polyclonal antibody (D01)

EPM2A MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00007957-D01
EPM2A MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EPM2A protein.
Información adicional
Size 100 uL
Gene Name EPM2A
Gene Alias EPM2|MELF
Gene Description epilepsy, progressive myoclonus type 2A, Lafora disease (laforin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MRFRFGVVVPPAVAGARPELLVVGSRPELGRWEPRGAVRLRPAGTAAGDGALALQEPGLWLGEVELAAEEAAQDGAEPGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFKTEWDIVQNSSGCNRYPEPMTPDTMIKLYREEGLAYIWMPTPDMSTEGRVQMLPQAVCLLHAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EPM2A (AAH70047.1, 1 a.a. ~ 331 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7957

Enviar un mensaje


EPM2A MaxPab rabbit polyclonal antibody (D01)

EPM2A MaxPab rabbit polyclonal antibody (D01)