EPM2A polyclonal antibody (A01)
  • EPM2A polyclonal antibody (A01)

EPM2A polyclonal antibody (A01)

Ref: AB-H00007957-A01
EPM2A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EPM2A.
Información adicional
Size 50 uL
Gene Name EPM2A
Gene Alias EPM2|MELF
Gene Description epilepsy, progressive myoclonus type 2A, Lafora disease (laforin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPM2A (NP_001018051, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7957

Enviar un mensaje


EPM2A polyclonal antibody (A01)

EPM2A polyclonal antibody (A01)