ARMET monoclonal antibody (M01), clone 1D10
  • ARMET monoclonal antibody (M01), clone 1D10

ARMET monoclonal antibody (M01), clone 1D10

Ref: AB-H00007873-M01
ARMET monoclonal antibody (M01), clone 1D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ARMET.
Información adicional
Size 100 ug
Gene Name ARMET
Gene Alias ARP|MANF|MGC142148|MGC142150
Gene Description arginine-rich, mutated in early stage tumors
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq DSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARMET (NP_006001.2, 116 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7873
Clone Number 1D10
Iso type IgG1 Kappa

Enviar un mensaje


ARMET monoclonal antibody (M01), clone 1D10

ARMET monoclonal antibody (M01), clone 1D10