FZD5 purified MaxPab rabbit polyclonal antibody (D01P)
  • FZD5 purified MaxPab rabbit polyclonal antibody (D01P)

FZD5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007855-D01P
FZD5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FZD5 protein.
Información adicional
Size 100 ug
Gene Name FZD5
Gene Alias C2orf31|DKFZp434E2135|HFZ5|MGC129692
Gene Description frizzled homolog 5 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FZD5 (ENSP00000354607, 1 a.a. ~ 585 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7855

Enviar un mensaje


FZD5 purified MaxPab rabbit polyclonal antibody (D01P)

FZD5 purified MaxPab rabbit polyclonal antibody (D01P)