IL1R2 monoclonal antibody (M01), clone 1G12
  • IL1R2 monoclonal antibody (M01), clone 1G12

IL1R2 monoclonal antibody (M01), clone 1G12

Ref: AB-H00007850-M01
IL1R2 monoclonal antibody (M01), clone 1G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL1R2.
Información adicional
Size 100 ug
Gene Name IL1R2
Gene Alias CD121b|IL1RB|MGC47725
Gene Description interleukin 1 receptor, type II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq HTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL1R2 (NP_004624, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7850
Clone Number 1G12
Iso type IgG2a Kappa

Enviar un mensaje


IL1R2 monoclonal antibody (M01), clone 1G12

IL1R2 monoclonal antibody (M01), clone 1G12