IL1R2 purified MaxPab rabbit polyclonal antibody (D01P)
  • IL1R2 purified MaxPab rabbit polyclonal antibody (D01P)

IL1R2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007850-D01P
IL1R2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL1R2 protein.
Información adicional
Size 100 ug
Gene Name IL1R2
Gene Alias CD121b|IL1RB|MGC47725
Gene Description interleukin 1 receptor, type II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVIISPLKTISASLGSRLT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL1R2 (NP_004624.1, 1 a.a. ~ 398 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7850

Enviar un mensaje


IL1R2 purified MaxPab rabbit polyclonal antibody (D01P)

IL1R2 purified MaxPab rabbit polyclonal antibody (D01P)