PAX8 monoclonal antibody (M09J), clone 3H7
  • PAX8 monoclonal antibody (M09J), clone 3H7

PAX8 monoclonal antibody (M09J), clone 3H7

Ref: AB-H00007849-M09J
PAX8 monoclonal antibody (M09J), clone 3H7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PAX8.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name PAX8
Gene Alias -
Gene Description paired box 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAX8 (AAH01060, 1 a.a. ~ 450 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7849
Clone Number 3H7
Iso type IgG2a Kappa

Enviar un mensaje


PAX8 monoclonal antibody (M09J), clone 3H7

PAX8 monoclonal antibody (M09J), clone 3H7