BSND purified MaxPab rabbit polyclonal antibody (D01P)
  • BSND purified MaxPab rabbit polyclonal antibody (D01P)

BSND purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007809-D01P
BSND purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BSND protein.
Información adicional
Size 100 ug
Gene Name BSND
Gene Alias BART|MGC119283|MGC119284|MGC119285
Gene Description Bartter syndrome, infantile, with sensorineural deafness (Barttin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BSND (NP_476517.1, 1 a.a. ~ 320 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7809

Enviar un mensaje


BSND purified MaxPab rabbit polyclonal antibody (D01P)

BSND purified MaxPab rabbit polyclonal antibody (D01P)