LRP8 polyclonal antibody (A01)
  • LRP8 polyclonal antibody (A01)

LRP8 polyclonal antibody (A01)

Ref: AB-H00007804-A01
LRP8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LRP8.
Información adicional
Size 50 uL
Gene Name LRP8
Gene Alias APOER2|HSZ75190|MCI1
Gene Description low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LRP8 (NP_004622, 83 a.a. ~ 170 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7804

Enviar un mensaje


LRP8 polyclonal antibody (A01)

LRP8 polyclonal antibody (A01)