PTP4A1 purified MaxPab mouse polyclonal antibody (B01P)
  • PTP4A1 purified MaxPab mouse polyclonal antibody (B01P)

PTP4A1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007803-B01P
PTP4A1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PTP4A1 protein.
Información adicional
Size 50 ug
Gene Name PTP4A1
Gene Alias DKFZp779M0721|HH72|PRL-1|PRL1|PTP(CAAX1)|PTPCAAX1
Gene Description protein tyrosine phosphatase type IVA, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTP4A1 (NP_003454.1, 1 a.a. ~ 173 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7803

Enviar un mensaje


PTP4A1 purified MaxPab mouse polyclonal antibody (B01P)

PTP4A1 purified MaxPab mouse polyclonal antibody (B01P)