ZYX purified MaxPab rabbit polyclonal antibody (D01P)
  • ZYX purified MaxPab rabbit polyclonal antibody (D01P)

ZYX purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007791-D01P
ZYX purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZYX protein.
Información adicional
Size 100 ug
Gene Name ZYX
Gene Alias ESP-2|HED-2
Gene Description zyxin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPRGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZYX (NP_001010972.1, 1 a.a. ~ 572 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7791

Enviar un mensaje


ZYX purified MaxPab rabbit polyclonal antibody (D01P)

ZYX purified MaxPab rabbit polyclonal antibody (D01P)