ZNF223 MaxPab mouse polyclonal antibody (B01P)
  • ZNF223 MaxPab mouse polyclonal antibody (B01P)

ZNF223 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007766-B01P
ZNF223 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF223 protein.
Información adicional
Size 50 ug
Gene Name ZNF223
Gene Alias -
Gene Description zinc finger protein 223
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MTMSKEAVTFKDVAVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQPFHRDTFHFLREEKFWMMDIATQREGNSGGKIQPEMKTFPEAGPHEGWSCQQIWEEIASDLTRPQDSTIKSSQFFEQGDAHSQVEEGISIMHTGQKPSNCGKCKQSFSDMSIFDLPQQIRSAEKSHSCDECGKSFCYISALHIHQRVHLGEKLFKCDVCGKEFSQSLHLQTHQRVHTGEKPFKCEQCGRGFRCRSALTVHCKLHM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF223 (NP_037493.2, 1 a.a. ~ 482 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7766

Enviar un mensaje


ZNF223 MaxPab mouse polyclonal antibody (B01P)

ZNF223 MaxPab mouse polyclonal antibody (B01P)