ZNF213 monoclonal antibody (M02), clone 3D3
  • ZNF213 monoclonal antibody (M02), clone 3D3

ZNF213 monoclonal antibody (M02), clone 3D3

Ref: AB-H00007760-M02
ZNF213 monoclonal antibody (M02), clone 3D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF213.
Información adicional
Size 100 ug
Gene Name ZNF213
Gene Alias CR53|ZKSCAN21
Gene Description zinc finger protein 213
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq QDVPSEEAEPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRNTTLGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF213 (NP_004211, 133 a.a. ~ 242 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7760
Clone Number 3D3
Iso type IgG1 Kappa

Enviar un mensaje


ZNF213 monoclonal antibody (M02), clone 3D3

ZNF213 monoclonal antibody (M02), clone 3D3