ZNF200 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF200 purified MaxPab mouse polyclonal antibody (B01P)

ZNF200 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007752-B01P
ZNF200 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF200 protein.
Información adicional
Size 50 ug
Gene Name ZNF200
Gene Alias MGC45293
Gene Description zinc finger protein 200
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAKVVPMPPKPKQSFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHFLTFLPKPSLVQPSQKVKETLVIMKDVSSSLQNRVHPRPLVKLLPKGVQKEQETVSLYLKANPEELVVFEDLNVFHCQEECVSLDPTQQLTSEKEDDSSVGEMMLLVNGSNPEGEDPEREPVENEDYREKSSDDDEMDSSLVSQQPPDNQEKERLNTSIPQKRKMRNLLVTIENDTPLEELSKYVDISIIALTRNRRTRRWYTCPLC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF200 (AAH54005.1, 1 a.a. ~ 393 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7752

Enviar un mensaje


ZNF200 purified MaxPab mouse polyclonal antibody (B01P)

ZNF200 purified MaxPab mouse polyclonal antibody (B01P)