ZNF174 MaxPab mouse polyclonal antibody (B02P)
  • ZNF174 MaxPab mouse polyclonal antibody (B02P)

ZNF174 MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00007727-B02P
ZNF174 MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF174 protein.
Información adicional
Size 50 ug
Gene Name ZNF174
Gene Alias ZSCAN8
Gene Description zinc finger protein 174
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF174 (NP_001027463.1, 1 a.a. ~ 234 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7727

Enviar un mensaje


ZNF174 MaxPab mouse polyclonal antibody (B02P)

ZNF174 MaxPab mouse polyclonal antibody (B02P)