TRIM26 monoclonal antibody (M01), clone 1G3
  • TRIM26 monoclonal antibody (M01), clone 1G3

TRIM26 monoclonal antibody (M01), clone 1G3

Ref: AB-H00007726-M01
TRIM26 monoclonal antibody (M01), clone 1G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM26.
Información adicional
Size 100 ug
Gene Name TRIM26
Gene Alias AFP|RNF95|ZNF173
Gene Description tripartite motif-containing 26
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq REKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM26 (NP_003440.1, 146 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7726
Clone Number 1G3
Iso type IgG2a Kappa

Enviar un mensaje


TRIM26 monoclonal antibody (M01), clone 1G3

TRIM26 monoclonal antibody (M01), clone 1G3