TRIM26 purified MaxPab mouse polyclonal antibody (B01P)
  • TRIM26 purified MaxPab mouse polyclonal antibody (B01P)

TRIM26 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007726-B01P
TRIM26 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIM26 protein.
Información adicional
Size 50 ug
Gene Name TRIM26
Gene Alias AFP|RNF95|ZNF173
Gene Description tripartite motif-containing 26
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPFKKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVMCRESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM26 (NP_003440.1, 1 a.a. ~ 539 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7726

Enviar un mensaje


TRIM26 purified MaxPab mouse polyclonal antibody (B01P)

TRIM26 purified MaxPab mouse polyclonal antibody (B01P)