Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ZBTB16 monoclonal antibody (M01), clone 3A7
Abnova
ZBTB16 monoclonal antibody (M01), clone 3A7
Ref: AB-H00007704-M01
ZBTB16 monoclonal antibody (M01), clone 3A7
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ZBTB16.
Información adicional
Size
100 ug
Gene Name
ZBTB16
Gene Alias
PLZF|ZNF145
Gene Description
zinc finger and BTB domain containing 16
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq
QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZBTB16 (AAH29812, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
7704
Clone Number
3A7
Iso type
IgG2a Kappa
Enviar un mensaje
ZBTB16 monoclonal antibody (M01), clone 3A7
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*