Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ZNF137 MaxPab mouse polyclonal antibody (B01P)
Abnova
ZNF137 MaxPab mouse polyclonal antibody (B01P)
Ref: AB-H00007696-B01P
ZNF137 MaxPab mouse polyclonal antibody (B01P)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a full-length human ZNF137 protein.
Información adicional
Size
50 ug
Gene Name
ZNF137
Gene Alias
MGC119990|MGC119991|pHZ-30
Gene Description
zinc finger protein 137
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MNVARFLVEKHTLHVIIDFILSKVSNQQSNLAQHQRVYTGEKPYKCNEWGKALSGKSSLFYHQAIHGVGKLCKCNDCHKVFSNATTIANHWRIHNEDRSYKCNKCGKIFRHRSYLAVYQRTHTGEKPYKYHDCGKVFSQASSYAKHRRIHTGEKPHKCDDCGKVLTSRSHLIRHQRIHTGQKSYKCLKCGKVFSLWALHAEHQKIHF
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ZNF137 (NP_003429.1, 1 a.a. ~ 207 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
7696
Enviar un mensaje
ZNF137 MaxPab mouse polyclonal antibody (B01P)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*