ZNF134 MaxPab mouse polyclonal antibody (B01P)
  • ZNF134 MaxPab mouse polyclonal antibody (B01P)

ZNF134 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007693-B01P
ZNF134 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF134 protein.
Información adicional
Size 50 ug
Gene Name ZNF134
Gene Alias MGC138499|MGC141970|pHZ-15
Gene Description zinc finger protein 134
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MTLVTAGGAWTGPGCWHEVKDEESSSEQSISIAVSHVNTSKAGLPAQTALPCDICGPILKDILHLDEHQGTHHGLKLHTCGACGRQFWFSANLHQYQKCYSIEQPLRRDKSEASIVKNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQHQRIHSGEKPYECSECGKAFSRKATLVQHQRIHTGERPYECSECGKTFSRKDNLTQHKRIHT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF134 (AAI13411.1, 1 a.a. ~ 427 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7693

Enviar un mensaje


ZNF134 MaxPab mouse polyclonal antibody (B01P)

ZNF134 MaxPab mouse polyclonal antibody (B01P)