ZNF69 monoclonal antibody (M08), clone 1E3
  • ZNF69 monoclonal antibody (M08), clone 1E3

ZNF69 monoclonal antibody (M08), clone 1E3

Ref: AB-H00007620-M08
ZNF69 monoclonal antibody (M08), clone 1E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF69.
Información adicional
Size 100 ug
Gene Name ZNF69
Gene Alias Cos5|MGC59928
Gene Description zinc finger protein 69
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MPCCSHRRCREDPGTSESQEMEEWALLDISQRKLYKEVMLETFRNLTSVGKSWKDQNIEYEYQNPRRNFRSLIEKKVNEIK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF69 (NP_068734.1, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7620
Clone Number 1E3
Iso type IgG2a Kappa

Enviar un mensaje


ZNF69 monoclonal antibody (M08), clone 1E3

ZNF69 monoclonal antibody (M08), clone 1E3