ZNF42 polyclonal antibody (A01)
  • ZNF42 polyclonal antibody (A01)

ZNF42 polyclonal antibody (A01)

Ref: AB-H00007593-A01
ZNF42 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ZNF42.
Información adicional
Size 50 uL
Gene Name MZF1
Gene Alias MZF-1|MZF1B|ZNF42|ZSCAN6|Zfp98
Gene Description myeloid zinc finger 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QGFVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPGAKPPAPPGAPEPPGPFPCSECRESFARRAVLLEHQAVHTGDKSFGCVEC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF42 (NP_003413, 419 a.a. ~ 518 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7593

Enviar un mensaje


ZNF42 polyclonal antibody (A01)

ZNF42 polyclonal antibody (A01)