ZNF31 monoclonal antibody (M02), clone 3G7
  • ZNF31 monoclonal antibody (M02), clone 3G7

ZNF31 monoclonal antibody (M02), clone 3G7

Ref: AB-H00007579-M02
ZNF31 monoclonal antibody (M02), clone 3G7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ZNF31.
Información adicional
Size 100 ug
Gene Name ZSCAN20
Gene Alias KOX29|ZFP-31|ZNF31|ZNF360
Gene Description zinc finger and SCAN domain containing 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAMALELQAQASPQPEPEELLIVKLEEDSWGSESKLWEKDRGSVSGPEASRQRFRQFQYRDAAGPHEAFSQLWALCCRWLRPEIRLKEQILELLVLEQFLTILPREVQTWVQARHPESGEEAVALVEDWHRETRTAGQSGLELHTEETRPLKTGEEAQSFQLQPVDPWPEGQSQKKGVKNTCPDLPNHLNAEVAPQPLKESGVPVSKPSNTSEKEQGPEFWGLSLINSGKRSTADYSLDNEPAQALTWRDSRAWE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF31 (AAH11404, 1 a.a. ~ 433 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7579
Clone Number 3G7
Iso type IgG2a Kappa

Enviar un mensaje


ZNF31 monoclonal antibody (M02), clone 3G7

ZNF31 monoclonal antibody (M02), clone 3G7