ZNF28 monoclonal antibody (M01), clone 8H6
  • ZNF28 monoclonal antibody (M01), clone 8H6

ZNF28 monoclonal antibody (M01), clone 8H6

Ref: AB-H00007576-M01
ZNF28 monoclonal antibody (M01), clone 8H6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ZNF28.
Información adicional
Size 100 ug
Gene Name ZNF28
Gene Alias DKFZp781D0275|KOX24
Gene Description zinc finger protein 28
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLGEDNLLGMCPCVSLYFLLLPLGSHILT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF28 (AAH70146.1, 1 a.a. ~ 74 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7576
Clone Number 8H6
Iso type IgG2a Kappa

Enviar un mensaje


ZNF28 monoclonal antibody (M01), clone 8H6

ZNF28 monoclonal antibody (M01), clone 8H6