ZNF18 purified MaxPab rabbit polyclonal antibody (D01P)
  • ZNF18 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF18 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007566-D01P
ZNF18 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZNF18 protein.
Información adicional
Size 100 ug
Gene Name ZNF18
Gene Alias HDSG1|KOX11|ZKSCAN6|ZNF535|Zfp535
Gene Description zinc finger protein 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPVDLGQALGLLPSLAKAEDSQFSESDAALQEELSSPETARQLFRQFRYQVMSGPHETLKQLRKLCFQWLQPEVHTKEQILEILMLEQFLTILPGEIQMWVRKQCPGSGEEAVTLVESLKGDPQRLWQWISIQVLGQDILSEKMESPSCQVGEVEPHLEVVPQELGLENSSSGPGELLSHIVKEESDTEAELALAASQPARLEERLIRDRDLGASLLPAAPQEQWRQLDSTQKEQYWDLILETYGKMVSGAGISH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF18 (AAH36096.1, 1 a.a. ~ 549 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7566

Enviar un mensaje


ZNF18 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF18 purified MaxPab rabbit polyclonal antibody (D01P)