ZNF8 monoclonal antibody (M03), clone 2C6
  • ZNF8 monoclonal antibody (M03), clone 2C6

ZNF8 monoclonal antibody (M03), clone 2C6

Ref: AB-H00007554-M03
ZNF8 monoclonal antibody (M03), clone 2C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF8.
Información adicional
Size 100 ug
Gene Name ZNF8
Gene Alias HF.18|Zfp128
Gene Description zinc finger protein 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ELWVAERGTTQGCHPAWEPRSESQASRKEEGLPEEEPSHVTGREGFPTDAPYPTTLGKDRECQSQSLALKEQNNLKQLEFGLKEAPVQDQGYKTLRLRE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF8 (NP_066575.1, 82 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7554
Clone Number 2C6
Iso type IgG2a Kappa

Enviar un mensaje


ZNF8 monoclonal antibody (M03), clone 2C6

ZNF8 monoclonal antibody (M03), clone 2C6