Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ZIC3 monoclonal antibody (M06), clone 2G1
Abnova
ZIC3 monoclonal antibody (M06), clone 2G1
Ref: AB-H00007547-M06
ZIC3 monoclonal antibody (M06), clone 2G1
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a full length recombinant ZIC3.
Información adicional
Size
100 ug
Gene Name
ZIC3
Gene Alias
HTX|HTX1|ZNF203
Gene Description
Zic family member 3 (odd-paired homolog, Drosophila)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA,IF
Immunogen Prot. Seq
NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZIC3 (NP_003404.1, 182 a.a. ~ 274 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
7547
Clone Number
2G1
Iso type
IgG2a Kappa
Enviar un mensaje
ZIC3 monoclonal antibody (M06), clone 2G1
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*