ZIC3 monoclonal antibody (M05), clone 2C1
  • ZIC3 monoclonal antibody (M05), clone 2C1

ZIC3 monoclonal antibody (M05), clone 2C1

Ref: AB-H00007547-M05
ZIC3 monoclonal antibody (M05), clone 2C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZIC3.
Información adicional
Size 100 ug
Gene Name ZIC3
Gene Alias HTX|HTX1|ZNF203
Gene Description Zic family member 3 (odd-paired homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZIC3 (NP_003404.1, 182 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7547
Clone Number 2C1
Iso type IgG2a Kappa

Enviar un mensaje


ZIC3 monoclonal antibody (M05), clone 2C1

ZIC3 monoclonal antibody (M05), clone 2C1