ZIC1 monoclonal antibody (M11), clone 2F6
  • ZIC1 monoclonal antibody (M11), clone 2F6

ZIC1 monoclonal antibody (M11), clone 2F6

Ref: AB-H00007545-M11
ZIC1 monoclonal antibody (M11), clone 2F6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ZIC1.
Información adicional
Size 100 ug
Gene Name ZIC1
Gene Alias ZIC|ZNF201
Gene Description Zic family member 1 (odd-paired homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGAGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZIC1 (NP_003403, 139 a.a. ~ 212 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7545
Clone Number 2F6
Iso type IgG2b Kappa

Enviar un mensaje


ZIC1 monoclonal antibody (M11), clone 2F6

ZIC1 monoclonal antibody (M11), clone 2F6