YWHAZ purified MaxPab mouse polyclonal antibody (B02P)
  • YWHAZ purified MaxPab mouse polyclonal antibody (B02P)

YWHAZ purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00007534-B02P
YWHAZ purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human YWHAZ protein.
Información adicional
Size 50 ug
Gene Name YWHAZ
Gene Alias KCIP-1|MGC111427|MGC126532|MGC138156
Gene Description tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen YWHAZ (NP_003397.1, 1 a.a. ~ 245 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7534

Enviar un mensaje


YWHAZ purified MaxPab mouse polyclonal antibody (B02P)

YWHAZ purified MaxPab mouse polyclonal antibody (B02P)