Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
YWHAH monoclonal antibody (M07), clone 1C2
Abnova
YWHAH monoclonal antibody (M07), clone 1C2
Ref: AB-H00007533-M07
YWHAH monoclonal antibody (M07), clone 1C2
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant YWHAH.
Información adicional
Size
100 ug
Gene Name
YWHAH
Gene Alias
YWHA1
Gene Description
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHP
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
YWHAH (AAH03047, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
7533
Clone Number
1C2
Iso type
IgG1 Kappa
Enviar un mensaje
YWHAH monoclonal antibody (M07), clone 1C2
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*