Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
YWHAH polyclonal antibody (A01)
Abnova
YWHAH polyclonal antibody (A01)
Ref: AB-H00007533-A01
YWHAH polyclonal antibody (A01)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a partial recombinant YWHAH.
Información adicional
Size
50 uL
Gene Name
YWHAH
Gene Alias
YWHA1
Gene Description
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq
MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHP
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
YWHAH (AAH03047, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
7533
Enviar un mensaje
YWHAH polyclonal antibody (A01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*