YWHAG monoclonal antibody (M01), clone 3G3
  • YWHAG monoclonal antibody (M01), clone 3G3

YWHAG monoclonal antibody (M01), clone 3G3

Ref: AB-H00007532-M01
YWHAG monoclonal antibody (M01), clone 3G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant YWHAG.
Información adicional
Size 100 ug
Gene Name YWHAG
Gene Alias 14-3-3GAMMA
Gene Description tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq EQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen YWHAG (NP_036611, 67 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7532
Clone Number 3G3
Iso type IgG2a lambda

Enviar un mensaje


YWHAG monoclonal antibody (M01), clone 3G3

YWHAG monoclonal antibody (M01), clone 3G3