YWHAG polyclonal antibody (A02)
  • YWHAG polyclonal antibody (A02)

YWHAG polyclonal antibody (A02)

Ref: AB-H00007532-A02
YWHAG polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant YWHAG.
Información adicional
Size 50 uL
Gene Name YWHAG
Gene Alias 14-3-3GAMMA
Gene Description tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen YWHAG (NP_036611, 70 a.a. ~ 169 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7532

Enviar un mensaje


YWHAG polyclonal antibody (A02)

YWHAG polyclonal antibody (A02)