YWHAB polyclonal antibody (A01)
  • YWHAB polyclonal antibody (A01)

YWHAB polyclonal antibody (A01)

Ref: AB-H00007529-A01
YWHAB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant YWHAB.
Información adicional
Size 50 uL
Gene Name YWHAB
Gene Alias GW128|HS1|KCIP-1
Gene Description tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEERQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen YWHAB (AAH01359, 1 a.a. ~ 246 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7529

Enviar un mensaje


YWHAB polyclonal antibody (A01)

YWHAB polyclonal antibody (A01)