XPA MaxPab rabbit polyclonal antibody (D01)
  • XPA MaxPab rabbit polyclonal antibody (D01)

XPA MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00007507-D01
XPA MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human XPA protein.
Información adicional
Size 100 uL
Gene Name XPA
Gene Alias XP1|XPAC
Gene Description xeroderma pigmentosum, complementation group A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen XPA (NP_000371.1, 1 a.a. ~ 273 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7507

Enviar un mensaje


XPA MaxPab rabbit polyclonal antibody (D01)

XPA MaxPab rabbit polyclonal antibody (D01)