XBP1 purified MaxPab mouse polyclonal antibody (B01P)
  • XBP1 purified MaxPab mouse polyclonal antibody (B01P)

XBP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007494-B01P
XBP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human XBP1 protein.
Información adicional
Size 50 ug
Gene Name XBP1
Gene Alias TREB5|XBP2
Gene Description X-box binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen XBP1 (NP_005071.2, 1 a.a. ~ 261 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7494

Enviar un mensaje


XBP1 purified MaxPab mouse polyclonal antibody (B01P)

XBP1 purified MaxPab mouse polyclonal antibody (B01P)