WNT7B purified MaxPab mouse polyclonal antibody (B01P)
  • WNT7B purified MaxPab mouse polyclonal antibody (B01P)

WNT7B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007477-B01P
WNT7B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human WNT7B protein.
Información adicional
Size 50 ug
Gene Name WNT7B
Gene Alias -
Gene Description wingless-type MMTV integration site family, member 7B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen WNT7B (NP_478679.1, 1 a.a. ~ 349 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7477

Enviar un mensaje


WNT7B purified MaxPab mouse polyclonal antibody (B01P)

WNT7B purified MaxPab mouse polyclonal antibody (B01P)