Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
WAS monoclonal antibody (M05), clone 3H5
Abnova
WAS monoclonal antibody (M05), clone 3H5
Ref: AB-H00007454-M05
WAS monoclonal antibody (M05), clone 3H5
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant WAS.
Información adicional
Size
100 ug
Gene Name
WAS
Gene Alias
IMD2|THC|WASP
Gene Description
Wiskott-Aldrich syndrome (eczema-thrombocytopenia)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
LPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEER
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
WAS (NP_000368, 57 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
7454
Clone Number
3H5
Iso type
IgG2b Kappa
Enviar un mensaje
WAS monoclonal antibody (M05), clone 3H5
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*